HORDB

ID: hor002970
Uniprot ID: P16859
Protein name: Brain natriuretic peptide 34
Gene name: NPPB
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Family: Natriuretic peptide family
Source: animal
Expression: Brain and also in atria, but at much lower levels than ANP.
Disease: NA
Comments: NA
Taxonomy: Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051427 hormone receptor binding
GO BP: GO:0003008 system process; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0019934 cGMP-mediated signaling; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence: LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY
Length: 34
Propeptide: MEPCAALPRALLLLLFLHLSPLGGRPHPLGGRSPASEASEASEASGLWAVQELLGRLKDAVSELQAEQLALEPLHRSHSPAEAPEAGGTPRGVLAPHDSVLQALRRLRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY
Signal peptide: MEPCAALPRALLLLLFLHLSPLGGRP
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q8S8N2-F1.pdb

hor002970_AF2.pdb

hor002970_ESM.pdb

Mass:	442639	Formula:	C164H279N55O43S4
Absent amino acids:	AEQTW	Common amino acids:	GLR
pI:	11.54	Basic residues:	9
Polar residues:	13	Hydrophobic residues:	8
Hydrophobicity:	-38.82	Boman Index:	-7651
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	77.35
Instability Index:	9406.47	Extinction Coefficient cystines:	1615
Absorbance 280nm:	48.94